PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462951878
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family VOZ
Protein Properties Length: 416aa    MW: 45719.7 Da    PI: 7.3561
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462951878genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ413.24.7e-1271103225217
        VOZ   5 aflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsllege 104
                +flgpkcalwdc rp+ gse+++dyc+ +ha laln++ +gt pv+rp+gidlkdg+lf al akvqgk+vgip+c+gaat+kspwna+elfdlsllege
  462951878 110 QFLGPKCALWDCGRPVGGSEECRDYCNPYHAGLALNDDGLGTIPVMRPRGIDLKDGPLFTALIAKVQGKNVGIPVCKGAATSKSPWNAPELFDLSLLEGE 209
                8*************************************************************************************************** PP

        VOZ 105 tirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskds 204
                ++rewlffd+prrafesgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpss++ewhl+eyein++dalalyrle+k++d+kksak+k+ ++s
  462951878 210 SLREWLFFDTPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSNYEWHLFEYEINDSDALALYRLEFKSSDAKKSAKSKLPSSS 309
                **************************************************************************************************** PP

        VOZ 205 ladlqkklgrlta 217
                l+++q++++rlta
  462951878 310 LNEIQQQMVRLTA 322
                ***********97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MAGDPAAGAG AGHPGSAGKG SRSSTRHRQF RDRAKTRVDD LQEIFSGLQS ARKESRSADA  60
ANLYEHGHGQ DGWMSNAQQQ GEGAQQSLEH GVQEGCGEVA AVANAMFSDQ FLGPKCALWD  120
CGRPVGGSEE CRDYCNPYHA GLALNDDGLG TIPVMRPRGI DLKDGPLFTA LIAKVQGKNV  180
GIPVCKGAAT SKSPWNAPEL FDLSLLEGES LREWLFFDTP RRAFESGNRK QRSLPDYNGR  240
GWHESRKQVM KDFGGLKRSY YMDPQPSSNY EWHLFEYEIN DSDALALYRL EFKSSDAKKS  300
AKSKLPSSSL NEIQQQMVRL TADSPVENKR TARNKPKSNQ KDSRANVYPA LNTPSQASAP  360
SAYQPVPQMD QMTFLNENVV YGPHLPHSEN IVYGPHLPHV YSAEGGSFWN PSDRAG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961501.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-108VOZ1_ARATH; Transcription factor VOZ1
TrEMBLK3Z4V00.0K3Z4V0_SETIT; Uncharacterized protein
STRINGSi021568m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-102vascular plant one zinc finger protein